Lineage for d8cy9f_ (8cy9 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 3086736Domain d8cy9f_: 8cy9 F: [423053]
    automated match to d6h16b_

Details for d8cy9f_

PDB Entry: 8cy9 (more details), 2.9 Å

PDB Description: sars-cov-2 spike protein in complex with a pan-sarbecovirus nanobody 1-23
PDB Compounds: (F:) pan-sarbecovirus nanobody 1-23

SCOPe Domain Sequences for d8cy9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cy9f_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgrtdsisdmgwfrqapgkerefvavvgwsgggtdy
ahsvkgrftisrdnakntvylqmnslkpedtavyycavgslrvgsfsveywgqgtqvtvs
s

SCOPe Domain Coordinates for d8cy9f_:

Click to download the PDB-style file with coordinates for d8cy9f_.
(The format of our PDB-style files is described here.)

Timeline for d8cy9f_:

  • d8cy9f_ appears in periodic updates to SCOPe 2.08 starting on 2022-09-21