Lineage for d8cy9e_ (8cy9 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 3086684Domain d8cy9e_: 8cy9 E: [423001]
    automated match to d6h16b_

Details for d8cy9e_

PDB Entry: 8cy9 (more details), 2.9 Å

PDB Description: sars-cov-2 spike protein in complex with a pan-sarbecovirus nanobody 1-23
PDB Compounds: (E:) pan-sarbecovirus nanobody 1-23

SCOPe Domain Sequences for d8cy9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cy9e_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgrtdsisdmgwfrqapgkerefvavvgwsgggtdy
ahsvkgrftisrdnakntvylqmnslkpedtavyycavgslrvgsfsveywgqgtqvtvs
s

SCOPe Domain Coordinates for d8cy9e_:

Click to download the PDB-style file with coordinates for d8cy9e_.
(The format of our PDB-style files is described here.)

Timeline for d8cy9e_:

  • d8cy9e_ is new in SCOPe 2.08-stable