Lineage for d7rk1d_ (7rk1 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 3085925Domain d7rk1d_: 7rk1 D: [422242]
    Other proteins in same PDB: d7rk1c2
    automated match to d4lash_

Details for d7rk1d_

PDB Entry: 7rk1 (more details), 2.05 Å

PDB Description: crystal structure of the human astrovirus serotype 8 capsid spike in complex with scfv 3e8, an astrovirus-neutralizing antibody, at 2.05-a resolution
PDB Compounds: (D:) scFv 3E8

SCOPe Domain Sequences for d7rk1d_:

Sequence, based on SEQRES records: (download)

>d7rk1d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvqlqesgpglvkpsqslsltcsvtgysitsgyywnwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvttedtatyycatfydgydywgqgttltvssggsg
gggsggggsggggsdivmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspkl
liywastrhtgvpdrftgsgsgtdytltissvqaedlalyycqqhystpftfgsgtklei

Sequence, based on observed residues (ATOM records): (download)

>d7rk1d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvqlqesgpglvkpsqslsltcsvtgysitsgyywnwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvttedtatyycatfydgydywgqgttltvsdivmt
qshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliywastrhtgvpdrftgs
gsgtdytltissvqaedlalyycqqhystpftfgsgtklei

SCOPe Domain Coordinates for d7rk1d_:

Click to download the PDB-style file with coordinates for d7rk1d_.
(The format of our PDB-style files is described here.)

Timeline for d7rk1d_:

  • d7rk1d_ appears in periodic updates to SCOPe 2.08 starting on 2022-02-10