SCOPe 2.08: Domain d7d9zl2: 7d9z L:111-217

Lineage for d7d9zl2 (7d9z L:111-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (5 PDB entries)

8. Domain d7d9zl2: 7d9z L:111-217 [421172]
   Other proteins in same PDB: d7d9zh_, d7d9zl1
   automated match to d5bk2d2
   complexed with edo, flc

Details for d7d9zl2

PDB Entry: 7d9z, 1.12 Å

PDB Description: crystal structure of anti-basigin fab fragment

PDB Compounds: (L:) Light chain of antibody Fab fragment

SCOPe Domain Sequences for d7d9zl2:

Sequence; same for both SEQRES and ATOM records:

>d7d9zl2 b.1.1.2 (L:111-217) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdctyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7d9zl2:

• d7d9zl2 is new in SCOPe 2.08-stable