Lineage for d7o78a_ (7o78 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813589Family b.80.1.4: Chondroitinase B [51144] (2 proteins)
    this is a repeat family; one repeat unit is 1dbg A:263-289 found in domain
  6. 2813596Protein automated matches [419272] (1 species)
    not a true protein
  7. 2813597Species Pseudopedobacter saltans [TaxId:762903] [420142] (1 PDB entry)
  8. 2813598Domain d7o78a_: 7o78 A: [418529]
    Other proteins in same PDB: d7o78b2
    automated match to d1ofla_

Details for d7o78a_

PDB Entry: 7o78 (more details), 1.58 Å

PDB Description: structure of the pl6 family chondroitinase b from pseudopedobacter saltans, pedsa3807
PDB Compounds: (A:) Polysaccharide lyase from Pseudopedobacter saltans, Pedsa3807

SCOPe Domain Sequences for d7o78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7o78a_ b.80.1.4 (A:) automated matches {Pseudopedobacter saltans [TaxId: 762903]}
khilvasvkevyskvdqlkagdtlllkdgiykdiqlvvkrsgskekpiviaaqnggkvff
tgdakvelrgeylvlkdiyfkdgnrnvnqwkshgpglvaiygsynrvtgcvfnafdeans
ayittslteegkvpkhcridhcvftdkitfdqvinlnnrpradkeskvlgeamyhridhc
ffsnppkpgnagggirvgyyrndigrclidsnlfvrqdseaeivtsksqenvyygntiln
cqgtlnfrhgdkqvalnnffistdnkygyggmfvwgsqhiiannyfnlkktikargnaal
ylnpgpegsehalafnslivnnffddnngydinfepllerrkefakevnaefklpyniti
egnlfaskqgdkhipflgnldknnlqnnysfgqmandklftnvkpttdgsynpqsykgyq
lanvkdikniegidldiqnlinkgiegnpltwndvrpswlveipgsyakegtldqetkir
fqrvlardrnn

SCOPe Domain Coordinates for d7o78a_:

Click to download the PDB-style file with coordinates for d7o78a_.
(The format of our PDB-style files is described here.)

Timeline for d7o78a_:

  • d7o78a_ is new in SCOPe 2.08-stable