SCOPe 2.08: Domain d6xc9d1: 6xc9 D:1-127

Lineage for d6xc9d1 (6xc9 D:1-127)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
Domain d6xc9d1: 6xc9 D:1-127 [417043]
Other proteins in same PDB: d6xc9a1, d6xc9a2, d6xc9a3, d6xc9d2, d6xc9e2, d6xc9f1, d6xc9f2, d6xc9i2, d6xc9j2
automated match to d6eh4d1
complexed with gol, nag

Details for d6xc9d1

PDB Entry: 6xc9 (more details), 2.4 Å

PDB Description: immune receptor complex

PDB Compounds: (D:) T-CELL-RECEPTOR, A3.10-alpha chain

SCOPe Domain Sequences for d6xc9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xc9d1 b.1.1.0 (D:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqtvtqsqpemsvqeaetvtlsctydtsesnyylfwykqppsrqmilvirqeaykqqnat
enrfsvnfqkaaksfslkisdsqlgdtamyfcaffgqgaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d6xc9d1:

Click to download the PDB-style file with coordinates for d6xc9d1.
(The format of our PDB-style files is described here.)

Timeline for d6xc9d1: