Lineage for d6pgkp_ (6pgk P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783757Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2783773Protein automated matches [347347] (4 species)
    not a true protein
  7. 2783782Species Thermosynechococcus elongatus [TaxId:197221] [377953] (5 PDB entries)
  8. 2783790Domain d6pgkp_: 6pgk P: [416443]
    Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgkf_, d6pgkg_, d6pgkh_, d6pgki_, d6pgkj_, d6pgkl_, d6pgkm_, d6pgkn_, d6pgko_, d6pgkq_, d6pgkr_, d6pgks_, d6pgku_, d6pgkv_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_
    automated match to d1qp2a_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pgkp_

PDB Entry: 6pgk (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i xfel at 2.9 a
PDB Compounds: (P:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d6pgkp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pgkp_ b.34.4.2 (P:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf
alhevqeva

SCOPe Domain Coordinates for d6pgkp_:

Click to download the PDB-style file with coordinates for d6pgkp_.
(The format of our PDB-style files is described here.)

Timeline for d6pgkp_:

  • d6pgkp_ is new in SCOPe 2.08-stable