Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins) automatically mapped to Pfam PF02427 |
Protein automated matches [347347] (4 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [377953] (5 PDB entries) |
Domain d6pgkp_: 6pgk P: [416443] Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgkf_, d6pgkg_, d6pgkh_, d6pgki_, d6pgkj_, d6pgkl_, d6pgkm_, d6pgkn_, d6pgko_, d6pgkq_, d6pgkr_, d6pgks_, d6pgku_, d6pgkv_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_ automated match to d1qp2a_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pgk (more details), 2.9 Å
SCOPe Domain Sequences for d6pgkp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pgkp_ b.34.4.2 (P:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} vqrgskvkilrpesywynevgtvasvdqtpgvkypvivrfdkvnytgysgsasgvntnnf alhevqeva
Timeline for d6pgkp_: