Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
Protein automated matches [347525] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [377769] (5 PDB entries) |
Domain d6pgkl_: 6pgk L: [416439] Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgke_, d6pgkf_, d6pgkg_, d6pgkh_, d6pgki_, d6pgkj_, d6pgkm_, d6pgkn_, d6pgko_, d6pgkp_, d6pgkq_, d6pgkr_, d6pgks_, d6pgkv_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_ automated match to d5oy0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pgk (more details), 2.9 Å
SCOPe Domain Sequences for d6pgkl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pgkl_ f.31.1.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag ffvgamgsafvaffllenflvvdgimtglfn
Timeline for d6pgkl_: