Lineage for d6pgkm_ (6pgk M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026233Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family) (S)
    automatically mapped to Pfam PF07465
  5. 3026234Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)
  6. 3026235Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species)
  7. 3026238Species Thermosynechococcus elongatus [TaxId:197221] [377772] (5 PDB entries)
  8. 3026246Domain d6pgkm_: 6pgk M: [416440]
    Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgke_, d6pgkf_, d6pgkg_, d6pgkh_, d6pgki_, d6pgkj_, d6pgkl_, d6pgkn_, d6pgko_, d6pgkp_, d6pgkq_, d6pgkr_, d6pgks_, d6pgku_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_
    automated match to d1jb0m_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pgkm_

PDB Entry: 6pgk (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i xfel at 2.9 a
PDB Compounds: (M:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6pgkm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pgkm_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]}
altdtqvyvalviallpavlafrlstelyk

SCOPe Domain Coordinates for d6pgkm_:

Click to download the PDB-style file with coordinates for d6pgkm_.
(The format of our PDB-style files is described here.)

Timeline for d6pgkm_:

  • d6pgkm_ is new in SCOPe 2.08-stable