SCOPe 2.08: Domain d6haqb_: 6haq B:

Lineage for d6haqb_ (6haq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:330879] [419985] (4 PDB entries)

8. Domain d6haqb_: 6haq B: [416061]
   automated match to d2vtca_
   complexed with act, cu, nag

Details for d6haqb_

PDB Entry: 6haq, 1.37 Å

PDB Description: afgh61b wild-type copper loaded

PDB Compounds: (B:) Endoglucanase, putative

SCOPe Domain Sequences for d6haqb_:

Sequence; same for both SEQRES and ATOM records:

>d6haqb_ b.1.18.0 (B:) automated matches {Neosartorya fumigata [TaxId: 330879]}
hgfvsgivadgkyyggylvnqypymsnppdtiawsttatdlgfvdgtgyqspdiichrda
kngkltatvaagsqiefqwttwpeshhgplitylapcngdcatvdkttlkfvkiaaqgli
dgsnppgvwaddemiannntatvtipasyapgnyvlrheiialhsagnlngaqnypqcfn
iqitgggsaqgsgtagtslykntdpgikfdiysdlsggypipgpalfn

Timeline for d6haqb_:

• d6haqb_ is new in SCOPe 2.08-stable