Lineage for d2vtca_ (2vtc A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (27 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.25: Glycoside hydrolase family 61 [418803] (1 protein)
Pfam PF03343Protein Cellulase Cel61B [419106] (1 species) Species Hypocrea jecorina [TaxId:51453] [419620] (1 PDB entry) 
Domain d2vtca_: 2vtc A: [412974]
complexed with ni
Details for d2vtca_
PDB Entry: 2vtc (more details), 1.6 Å
PDB Description: the structure of a glycoside hydrolase family 61 member, cel61b from the hypocrea jecorina.
PDB Compounds: (A:) cel61bSCOPe Domain Sequences for d2vtca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vtca_ b.1.18.25 (A:) Cellulase Cel61B {Hypocrea jecorina [TaxId: 51453]}
hgqvqnftingqynqgfildyyyqkqntghfpnvagwyaedldlgfispdqyttpdivch
knaapgaisataaagsnivfqwgpgvwphpygpivtyvvecsgscttvnknnlrwvkiqe
aginyntqvwaqqdlinqgnkwtvkipsslrpgnyvfrhellaahgassangmqnypqcv
niavtgsgtkalpagtpatqlykptdpgilfnpyttitsytipgpalw
SCOPe Domain Coordinates for d2vtca_:
Click to download the PDB-style file with coordinates for d2vtca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vtca_:
- d2vtca_ is new in SCOPe 2.08-stable
View in 3D
