Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Neosartorya fumigata [TaxId:330879] [419985] (4 PDB entries) |
Domain d6h1zb_: 6h1z B: [416040] automated match to d2vtca_ complexed with act, cu, na |
PDB Entry: 6h1z (more details), 1.57 Å
SCOPe Domain Sequences for d6h1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h1zb_ b.1.18.0 (B:) automated matches {Neosartorya fumigata [TaxId: 330879]} hgfvsgivadgkyyggylvnqypymsnppdtiawsttatdlgfvdgtgyqspdiichrda kngkltatvaagsqiefqwttwpeshhgplitylapcngdcatvdkttlkfvkiaaqgli dgsnppgvwaddemiannntatvtipasyapgnyvlrheiialhsagnlngaqnypqcfn iqitgggsaqgsgtagtslykntdpgikfdiysdlsggypipgpalfn
Timeline for d6h1zb_: