Lineage for d6utee_ (6ute E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743519Domain d6utee_: 6ute E: [411966]
    Other proteins in same PDB: d6uteb1, d6uteb2, d6uted1, d6uted2, d6utef1, d6utef2, d6uteh1, d6uteh2, d6utej1, d6utej2, d6utes_
    automated match to d6shgh_
    complexed with gol

Details for d6utee_

PDB Entry: 6ute (more details), 2.9 Å

PDB Description: crystal structure of z032 fab in complex with wnv ediii
PDB Compounds: (E:) Z032 Fab heavy chain

SCOPe Domain Sequences for d6utee_:

Sequence, based on SEQRES records: (download)

>d6utee_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggrlvqpggsltlscaasgfpfstyamswlrqapgkglewvsgitgdsgstyy
aasvkgrftisrdnskntlylqmnsltaddtavyycakdrlhsglgelfsywgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d6utee_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggrlvqpggsltlscaasgfpfstyamswlrqapgkglewvsgitgdsgstyy
aasvkgrftisrdnskntlylqmnsltaddtavyycakdrlhsglgelfsywgqgtlvtv
ssastkgpsvfplapsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d6utee_:

Click to download the PDB-style file with coordinates for d6utee_.
(The format of our PDB-style files is described here.)

Timeline for d6utee_:

  • d6utee_ is new in SCOPe 2.08-stable