Lineage for d6elub_ (6elu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744850Domain d6elub_: 6elu B: [411051]
    Other proteins in same PDB: d6eluc1, d6eluc2, d6eluf1, d6eluf2, d6elui1, d6elui2, d6elul1, d6elul2
    automated match to d6shgh_

Details for d6elub_

PDB Entry: 6elu (more details), 2.3 Å

PDB Description: structure of serum resistance associated protein from t. b. rhodesiense
PDB Compounds: (B:) G10_3 heavy chain

SCOPe Domain Sequences for d6elub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elub_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkleesggglvqpggslrvscatsgftftdyymnwvrqppgkalewlgfirnkangytt
eysasvkgrftisrddsqsilylqmntlraedsasyycardkgwgyamdywgqgtsvtvs
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d6elub_:

Click to download the PDB-style file with coordinates for d6elub_.
(The format of our PDB-style files is described here.)

Timeline for d6elub_:

  • d6elub_ is new in SCOPe 2.08-stable