PDB entry 6elu

View 6elu on RCSB PDB site
Description: Structure of Serum Resistance Associated protein from T. b. rhodesiense
Class: antitoxin
Keywords: Tryanosome, innate immune evasion, sleeping sickness, apolipoprotein LI, SRA, trypanolytic factor., ANTITOXIN
Deposited on 2017-09-29, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serum resistance associated; VSG protein
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: SRA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: G10_3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU
  • Chain 'C':
    Compound: G10_3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU (0-216)
    Domains in SCOPe 2.07: d6eluc1, d6eluc2
  • Chain 'D':
    Compound: Serum resistance associated; VSG protein
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: SRA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: G10_3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU
  • Chain 'F':
    Compound: G10_3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU (0-216)
    Domains in SCOPe 2.07: d6eluf1, d6eluf2
  • Chain 'G':
    Compound: Serum resistance associated; VSG protein
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: SRA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: G10_3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU
  • Chain 'I':
    Compound: G10_3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU (0-216)
    Domains in SCOPe 2.07: d6elui1, d6elui2
  • Chain 'J':
    Compound: Serum resistance associated; VSG protein
    Species: Trypanosoma brucei rhodesiense [TaxId:31286]
    Gene: SRA
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: G10_3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU
  • Chain 'L':
    Compound: G10_3 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ELU (0-216)
    Domains in SCOPe 2.07: d6elul1, d6elul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eluC (C:)
    divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eluF (F:)
    divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eluI (I:)
    divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eluL (L:)
    divmtqtppslavslgqratisckasqsvdydadsfmhwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnirpveeedaatyycqqsnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne