Lineage for d4f37f_ (4f37 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745155Domain d4f37f_: 4f37 F: [408905]
    Other proteins in same PDB: d4f37k2, d4f37l2
    automated match to d6shgh_

Details for d4f37f_

PDB Entry: 4f37 (more details), 2.57 Å

PDB Description: Structure of the tethered N-terminus of Alzheimer's disease A peptide
PDB Compounds: (F:) Im7 immunity protein

SCOPe Domain Sequences for d4f37f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f37f_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvtlkesgpgilqpsqtlsltcsfsgfslrtsrvgvswirqpsgkglewlahiywdddkr
ynpslesrltiskdtsrnqvflkitsvdtadtatyycarrgfygrkyevnhfdywgqgtt
ltvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpa
vlqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4f37f_:

Click to download the PDB-style file with coordinates for d4f37f_.
(The format of our PDB-style files is described here.)

Timeline for d4f37f_:

  • d4f37f_ is new in SCOPe 2.08-stable