PDB entry 4f37

View 4f37 on RCSB PDB site
Description: Structure of the tethered N-terminus of Alzheimer's disease A peptide
Class: immune system
Keywords: amyloid-beta, Alzheimer's disease, IMMUNE SYSTEM
Deposited on 2012-05-09, released 2013-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.226
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin-e7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03708 (17-End)
      • expression tag (0-16)
  • Chain 'B':
    Compound: colicin-e7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03708 (17-End)
      • expression tag (0-16)
  • Chain 'F':
    Compound: Im7 immunity protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F37 (0-End)
  • Chain 'H':
    Compound: Im7 immunity protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F37 (0-End)
  • Chain 'K':
    Compound: Fab WO2 anti-amyloid-beta antibody Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F37 (0-End)
    Domains in SCOPe 2.07: d4f37k1, d4f37k2
  • Chain 'L':
    Compound: Fab WO2 anti-amyloid-beta antibody Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F37 (0-End)
    Domains in SCOPe 2.07: d4f37l1, d4f37l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4f37K (K:)
    divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f37K (K:)
    divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4f37L (L:)
    divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f37L (L:)
    divmtqtplslpvslgdqasiscrssqtilhsngntylewylqkpgqspnlliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne