Lineage for d4cadh_ (4cad H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744696Domain d4cadh_: 4cad H: [408845]
    Other proteins in same PDB: d4cada1, d4cada2, d4cadd1, d4cadd2, d4cadg1, d4cadg2, d4cadj1, d4cadj2
    automated match to d6shgh_
    complexed with bog, lmt

Details for d4cadh_

PDB Entry: 4cad (more details), 2.5 Å

PDB Description: mechanism of farnesylated caax protein processing by the integral membrane protease rce1
PDB Compounds: (H:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d4cadh_:

Sequence, based on SEQRES records: (download)

>d4cadh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkqsgaelmkpgasvkisckatgykfssywiewvkqrpghglewigeifpgsgntny
nekfkgkatltadtssntaymqlssltsedsavyycarrgafysygssyyamdfwgqgts
vtvssakttppsdyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpa
vlqsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d4cadh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkqsgaelmkpgasvkisckatgykfssywiewvkqrpghglewigeifpgsgntny
nekfkgkatltadtssntaymqlssltsedsavyycarrgafysygssyyamdfwgqgts
vtvssakttppsdyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d4cadh_:

Click to download the PDB-style file with coordinates for d4cadh_.
(The format of our PDB-style files is described here.)

Timeline for d4cadh_:

  • d4cadh_ is new in SCOPe 2.08-stable