PDB entry 4cad

View 4cad on RCSB PDB site
Description: Mechanism of farnesylated CAAX protein processing by the integral membrane protease Rce1
Class: protein binding
Keywords: protein binding, integral membrane protease, monoclonal antibody fab fragment
Deposited on 2013-10-08, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2282
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD
    Domains in SCOPe 2.07: d4cada1, d4cada2
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD
  • Chain 'C':
    Compound: ras and a-factor converting enzyme 1, rce1
    Species: Methanococcus maripaludis [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD
    Domains in SCOPe 2.07: d4cadd1, d4cadd2
  • Chain 'E':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD
  • Chain 'F':
    Compound: ras and a-factor converting enzyme 1, rce1
    Species: Methanococcus maripaludis [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD (0-End)
    Domains in SCOPe 2.07: d4cadg1, d4cadg2
  • Chain 'H':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD (0-End)
  • Chain 'I':
    Compound: ras and a-factor converting enzyme 1, rce1
    Species: Methanococcus maripaludis [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD (0-End)
    Domains in SCOPe 2.07: d4cadj1, d4cadj2
  • Chain 'K':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CAD (0-End)
  • Chain 'L':
    Compound: ras and a-factor converting enzyme 1, rce1
    Species: Methanococcus maripaludis [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BOG, LMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cadA (A:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cadA (A:)
    iqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvpsr
    fsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cadD (D:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cadD (D:)
    iqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvpsr
    fsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cadG (G:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cadG (G:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4cadJ (J:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cadJ (J:)
    diqltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgnyycqhfwstpwtfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.