Lineage for d3ks0k_ (3ks0 K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745231Domain d3ks0k_: 3ks0 K: [408439]
    Other proteins in same PDB: d3ks0a_, d3ks0b_, d3ks0j1, d3ks0j2, d3ks0l1, d3ks0l2
    automated match to d6shgh_
    complexed with hem

Details for d3ks0k_

PDB Entry: 3ks0 (more details), 2.7 Å

PDB Description: crystal structure of the heme domain of flavocytochrome b2 in complex with fab b2b4
PDB Compounds: (K:) Fragment Antigen Binding B2B4

SCOPe Domain Sequences for d3ks0k_:

Sequence, based on SEQRES records: (download)

>d3ks0k_ b.1.1.1 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisyggstyyn
pslesrisitrdtsknqyylqlnsvttedtatyfcarlfgsyyfdywgqgttltvssakt
tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

Sequence, based on observed residues (ATOM records): (download)

>d3ks0k_ b.1.1.1 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisyggstyyn
pslesrisitrdtsknqyylqlnsvttedtatyfcarlfgsyyfdywgqgttltvssakt
tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
vpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOPe Domain Coordinates for d3ks0k_:

Click to download the PDB-style file with coordinates for d3ks0k_.
(The format of our PDB-style files is described here.)

Timeline for d3ks0k_:

  • d3ks0k_ is new in SCOPe 2.08-stable