Lineage for d3ks0b_ (3ks0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536940Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2536941Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2537053Family d.120.1.0: automated matches [191500] (1 protein)
    not a true family
  6. 2537054Protein automated matches [190822] (4 species)
    not a true protein
  7. 2537055Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225894] (1 PDB entry)
  8. 2537057Domain d3ks0b_: 3ks0 B: [212528]
    Other proteins in same PDB: d3ks0j1, d3ks0j2, d3ks0l1, d3ks0l2
    automated match to d2ibja_
    complexed with hem

Details for d3ks0b_

PDB Entry: 3ks0 (more details), 2.7 Å

PDB Description: Crystal structure of the heme domain of flavocytochrome b2 in complex with Fab B2B4
PDB Compounds: (B:) Cytochrome b2, mitochondrial

SCOPe Domain Sequences for d3ks0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ks0b_ d.120.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifepl
hapnvidkyiapekklgplqgsmppelvcppy

SCOPe Domain Coordinates for d3ks0b_:

Click to download the PDB-style file with coordinates for d3ks0b_.
(The format of our PDB-style files is described here.)

Timeline for d3ks0b_: