Lineage for d3inum_ (3inu M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743282Domain d3inum_: 3inu M: [408425]
    Other proteins in same PDB: d3inul1, d3inul2, d3inun1, d3inun2
    automated match to d6shgh_
    complexed with gol, so4

Details for d3inum_

PDB Entry: 3inu (more details), 2.5 Å

PDB Description: crystal structure of an unbound kz52 neutralizing anti-ebolavirus antibody.
PDB Compounds: (M:) KZ52 antibody fragment heavy chain

SCOPe Domain Sequences for d3inum_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3inum_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvkpggslrlscaasgftlinyrmnwvrqapgkglewvssisssssyihy
adsvkgrftisrdnaenslylqmnslraedtavyycvregpratgysmadvfdiwgqgtm
vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3inum_:

Click to download the PDB-style file with coordinates for d3inum_.
(The format of our PDB-style files is described here.)

Timeline for d3inum_:

  • d3inum_ is new in SCOPe 2.08-stable