PDB entry 3inu

View 3inu on RCSB PDB site
Description: Crystal structure of an unbound KZ52 neutralizing anti-Ebolavirus antibody.
Class: immune system
Keywords: antibody fragment (Fab), immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2009-08-12, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: KZ52 antibody fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3INU (0-225)
  • Chain 'L':
    Compound: KZ52 antibody fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3INU (0-216)
    Domains in SCOPe 2.07: d3inul1, d3inul2
  • Chain 'M':
    Compound: KZ52 antibody fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3INU (0-End)
  • Chain 'N':
    Compound: KZ52 antibody fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3INU (0-216)
    Domains in SCOPe 2.07: d3inun1, d3inun2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3inuL (L:)
    elvmtqspdslavslgeratinckssqsvlyssnnksylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysapltfgggtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglrspvtksfnr
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3inuN (N:)
    elvmtqspdslavslgeratinckssqsvlyssnnksylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysapltfgggtkveikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglrspvtksfnr