Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries) |
Domain d6z0xc_: 6z0x C: [407434] automated match to d3numa_ complexed with so4; mutant |
PDB Entry: 6z0x (more details), 3.1 Å
SCOPe Domain Sequences for d6z0xc_:
Sequence, based on SEQRES records: (download)
>d6z0xc_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnslrhkynfiarvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselqpgefvv aigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnaggplvnldgevi gintlkvtagisfaipsdkikkflteshdr
>d6z0xc_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnslrhkynfiarvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselqpgefvv aigspfslqntvttgivsttqsdmdyiqtdaiinygnaggplvnldgevigintlkvtag isfaipsdkikkflteshdr
Timeline for d6z0xc_: