Lineage for d6z0xc_ (6z0x C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407799Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 2407924Domain d6z0xc_: 6z0x C: [407434]
    automated match to d3numa_
    complexed with so4; mutant

Details for d6z0xc_

PDB Entry: 6z0x (more details), 3.1 Å

PDB Description: htra1 inactive protease domain s328a with carasil mutations d174r r274q
PDB Compounds: (C:) Serine protease HTRA1

SCOPe Domain Sequences for d6z0xc_:

Sequence, based on SEQRES records: (download)

>d6z0xc_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiarvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselqpgefvv
aigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnaggplvnldgevi
gintlkvtagisfaipsdkikkflteshdr

Sequence, based on observed residues (ATOM records): (download)

>d6z0xc_ b.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnslrhkynfiarvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselqpgefvv
aigspfslqntvttgivsttqsdmdyiqtdaiinygnaggplvnldgevigintlkvtag
isfaipsdkikkflteshdr

SCOPe Domain Coordinates for d6z0xc_:

Click to download the PDB-style file with coordinates for d6z0xc_.
(The format of our PDB-style files is described here.)

Timeline for d6z0xc_: