Lineage for d7n4da2 (7n4d A:85-157)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790570Species Naegleria fowleri [TaxId:5763] [405724] (1 PDB entry)
  8. 2790571Domain d7n4da2: 7n4d A:85-157 [405725]
    Other proteins in same PDB: d7n4da1, d7n4db1, d7n4dc1, d7n4dd1
    automated match to d5hy6a2

Details for d7n4da2

PDB Entry: 7n4d (more details), 2.45 Å

PDB Description: translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863
PDB Compounds: (A:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d7n4da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7n4da2 b.40.4.0 (A:85-157) automated matches {Naegleria fowleri [TaxId: 5763]}
vtrneyqvidisgeyvsimledgstrddlklpneteedktlaekikaafdegaefnvivm
samgvekivemkl

SCOPe Domain Coordinates for d7n4da2:

Click to download the PDB-style file with coordinates for d7n4da2.
(The format of our PDB-style files is described here.)

Timeline for d7n4da2: