Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [405724] (1 PDB entry) |
Domain d7n4da2: 7n4d A:85-157 [405725] Other proteins in same PDB: d7n4da1, d7n4db1, d7n4dc1, d7n4dd1 automated match to d5hy6a2 |
PDB Entry: 7n4d (more details), 2.45 Å
SCOPe Domain Sequences for d7n4da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7n4da2 b.40.4.0 (A:85-157) automated matches {Naegleria fowleri [TaxId: 5763]} vtrneyqvidisgeyvsimledgstrddlklpneteedktlaekikaafdegaefnvivm samgvekivemkl
Timeline for d7n4da2: