SCOPe 2.08: Domain d7n4dc2: 7n4d C:85-157

Lineage for d7n4dc2 (7n4d C:85-157)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [405724] (1 PDB entry)

8. Domain d7n4dc2: 7n4d C:85-157 [405778]
   Other proteins in same PDB: d7n4da1, d7n4db1, d7n4dc1, d7n4dd1
   automated match to d5hy6a2

Details for d7n4dc2

PDB Entry: 7n4d, 2.45 Å

PDB Description: translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863

PDB Compounds: (C:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d7n4dc2:

Sequence; same for both SEQRES and ATOM records:

>d7n4dc2 b.40.4.0 (C:85-157) automated matches {Naegleria fowleri [TaxId: 5763]}
vtrneyqvidisgeyvsimledgstrddlklpneteedktlaekikaafdegaefnvivm
samgvekivemkl

Timeline for d7n4dc2:

• d7n4dc2 first appeared in SCOPe 2.07