Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d7m7wf2: 7m7w F:114-216 [403661] Other proteins in same PDB: d7m7wa_, d7m7wb1, d7m7wc_, d7m7wd1, d7m7we_, d7m7wf1, d7m7wh_, d7m7wl1, d7m7wr_, d7m7ws_ automated match to d2fb4l2 complexed with nag |
PDB Entry: 7m7w (more details), 2.65 Å
SCOPe Domain Sequences for d7m7wf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m7wf2 b.1.1.2 (F:114-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d7m7wf2: