Lineage for d7d1ux_ (7d1u x:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632198Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries)
  8. 2632202Domain d7d1ux_: 7d1u x: [401866]
    Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1uz_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1ux_

PDB Entry: 7d1u (more details), 2.08 Å

PDB Description: cryo-em structure of psii at 2.08 angstrom resolution
PDB Compounds: (x:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d7d1ux_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1ux_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d7d1ux_:

Click to download the PDB-style file with coordinates for d7d1ux_.
(The format of our PDB-style files is described here.)

Timeline for d7d1ux_: