![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [196646] (4 PDB entries) |
![]() | Domain d7d1ua_: 7d1u a: [401867] Other proteins in same PDB: d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_ automated match to d2axta1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1u (more details), 2.08 Å
SCOPe Domain Sequences for d7d1ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1ua_ f.26.1.1 (a:) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus vulcanus [TaxId: 32053]} anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva ahgyfgrlifqyasfnnsrslhfflaawpvvgvwfaalgistmafnlngfnfnhsvidak gnvintwadiinranlgmevmhernahnfpldla
Timeline for d7d1ua_: