| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
| Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
| Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
| Domain d7d1uh_: 7d1u h: [401909] Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_ automated match to d5h2fh_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1u (more details), 2.08 Å
SCOPe Domain Sequences for d7d1uh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1uh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka
Timeline for d7d1uh_: