Lineage for d7d1uh_ (7d1u h:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631824Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2631834Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)
  8. 2631836Domain d7d1uh_: 7d1u h: [401909]
    Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_
    automated match to d5h2fh_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1uh_

PDB Entry: 7d1u (more details), 2.08 Å

PDB Description: cryo-em structure of psii at 2.08 angstrom resolution
PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7d1uh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1uh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d7d1uh_:

Click to download the PDB-style file with coordinates for d7d1uh_.
(The format of our PDB-style files is described here.)

Timeline for d7d1uh_: