![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
![]() | Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
![]() | Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
![]() | Domain d7d1ul_: 7d1u L: [401907] Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_, d7d1uz_ automated match to d3a0hl_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1u (more details), 2.08 Å
SCOPe Domain Sequences for d7d1ul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1ul_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d7d1ul_: