![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c550 [100991] (3 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries) |
![]() | Domain d7d1uv_: 7d1u v: [401911] Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1ux_, d7d1uz_ automated match to d3a0hv_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7d1u (more details), 2.08 Å
SCOPe Domain Sequences for d7d1uv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d1uv_ a.3.1.1 (v:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d7d1uv_: