Lineage for d6xlsa3 (6xls A:538-639)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766299Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (5 PDB entries)
  8. 2766302Domain d6xlsa3: 6xls A:538-639 [401075]
    Other proteins in same PDB: d6xlsa1, d6xlsa2
    automated match to d1gofa1
    complexed with act, ca, cu, f2y, gol

Details for d6xlsa3

PDB Entry: 6xls (more details), 1.8 Å

PDB Description: the 1.80 angstrom crystal structure of galactose oxidase variant with genetically incorporated f2-tyr272
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d6xlsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xlsa3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d6xlsa3:

Click to download the PDB-style file with coordinates for d6xlsa3.
(The format of our PDB-style files is described here.)

Timeline for d6xlsa3: