Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) |
Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins) |
Protein automated matches [254521] (1 species) not a true protein |
Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255146] (5 PDB entries) |
Domain d6xlsa2: 6xls A:151-537 [401074] Other proteins in same PDB: d6xlsa1, d6xlsa3 automated match to d1gofa3 complexed with act, ca, cu, f2y, gol |
PDB Entry: 6xls (more details), 1.8 Å
SCOPe Domain Sequences for d6xlsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xlsa2 b.69.1.1 (A:151-537) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafegspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gxqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrayhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylydsn
Timeline for d6xlsa2: