SCOPe 2.08: Domain d6xlsa2: 6xls A:151-537

Lineage for d6xlsa2 (6xls A:151-537)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein automated matches [254521] (1 species)
   not a true protein

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255146] (5 PDB entries)

8. Domain d6xlsa2: 6xls A:151-537 [401074]
   Other proteins in same PDB: d6xlsa1, d6xlsa3
   automated match to d1gofa3
   complexed with act, ca, cu, f2y, gol

Details for d6xlsa2

PDB Entry: 6xls, 1.8 Å

PDB Description: the 1.80 angstrom crystal structure of galactose oxidase variant with genetically incorporated f2-tyr272

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d6xlsa2:

Sequence; same for both SEQRES and ATOM records:

>d6xlsa2 b.69.1.1 (A:151-537) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafegspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gxqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrayhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylydsn

Timeline for d6xlsa2:

• d6xlsa2 first appeared in SCOPe 2.07