Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d7l0nn2: 7l0n N:108-213 [399502] Other proteins in same PDB: d7l0nb1, d7l0nd1, d7l0ne_, d7l0nf_, d7l0nh_, d7l0nl1, d7l0nm_, d7l0nn1, d7l0nr_, d7l0ns_ automated match to d1dn0a2 complexed with cl, na, nag, pg4, pg5, pge, so4, zn |
PDB Entry: 7l0n (more details), 2.78 Å
SCOPe Domain Sequences for d7l0nn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0nn2 b.1.1.2 (N:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d7l0nn2: