SCOPe 2.08: Domain d7l0nn2: 7l0n N:108-213

Lineage for d7l0nn2 (7l0n N:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7l0nn2: 7l0n N:108-213 [399502]
   Other proteins in same PDB: d7l0nb1, d7l0nd1, d7l0ne_, d7l0nf_, d7l0nh_, d7l0nl1, d7l0nm_, d7l0nn1, d7l0nr_, d7l0ns_
   automated match to d1dn0a2
   complexed with cl, na, nag, pg4, pg5, pge, so4, zn

Details for d7l0nn2

PDB Entry: 7l0n, 2.78 Å

PDB Description: circulating sars-cov-2 spike n439k variants maintain fitness while evading antibody-mediated immunity

PDB Compounds: (N:) Monoclonal antibody S304 Fab light chain

SCOPe Domain Sequences for d7l0nn2:

Sequence; same for both SEQRES and ATOM records:

>d7l0nn2 b.1.1.2 (N:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d7l0nn2:

• d7l0nn2 first appeared in SCOPe 2.07