Lineage for d7dstc_ (7dst C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2822070Protein automated matches [190854] (27 species)
    not a true protein
  7. 2822168Species Foot-and-mouth disease virus [TaxId:12110] [188180] (9 PDB entries)
  8. 2822175Domain d7dstc_: 7dst C: [398938]
    Other proteins in same PDB: d7dste_
    automated match to d1fmd3_

Details for d7dstc_

PDB Entry: 7dst (more details), 3.1 Å

PDB Description: fmdv capsid in complex with m170 nab
PDB Compounds: (C:) VP3 of O type FMDV capsid

SCOPe Domain Sequences for d7dstc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dstc_ b.121.4.1 (C:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
gifpvacsdgygglvttdpktadpvygkvfnpprnmlpgrftnlldvaeacptflhfdgd
vpyvttktdsdrvlaqfdlslaakhmsntflaglaqyytqysgtvnlhfmftgptdakar
ymiayappgmeppktpeaaahcihaewdtglnskftfsipylsaadyaytasdaaettnv
qgwvclfqithgkaegdalvvlasagkdfelrlpvdarq

SCOPe Domain Coordinates for d7dstc_:

Click to download the PDB-style file with coordinates for d7dstc_.
(The format of our PDB-style files is described here.)

Timeline for d7dstc_: