Lineage for d7belb1 (7bel B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756727Domain d7belb1: 7bel B:1-106 [398491]
    Other proteins in same PDB: d7bela_, d7belb2, d7belc_, d7beld2, d7belr_, d7belx_
    automated match to d1dn0a1
    complexed with act, bma, gol, man, nag

Details for d7belb1

PDB Entry: 7bel (more details), 2.53 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-88 and covox-45 fabs
PDB Compounds: (B:) COVOX-45 light chain

SCOPe Domain Sequences for d7belb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7belb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
rfsgggsgtdftftitslqpediatyycqqydnlpltfgggtkvdi

SCOPe Domain Coordinates for d7belb1:

Click to download the PDB-style file with coordinates for d7belb1.
(The format of our PDB-style files is described here.)

Timeline for d7belb1: