Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7bell1: 7bel L:1-95 [398522] Other proteins in same PDB: d7bela_, d7belb2, d7belc_, d7beld2, d7belr_, d7belx_ automated match to d4odhl1 complexed with act, bma, gol, man, nag |
PDB Entry: 7bel (more details), 2.53 Å
SCOPe Domain Sequences for d7bell1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bell1 b.1.1.0 (L:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsaltqppsvseaprqrvtiscsgsssnignnavnwyqqfpgkapklliyyddllpsgvs drfsgsksgtsaslaisgvqsedeadyycaawdds
Timeline for d7bell1: