SCOPe 2.08: Domain d7bell1: 7bel L:1-95

Lineage for d7bell1 (7bel L:1-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7bell1: 7bel L:1-95 [398522]
   Other proteins in same PDB: d7bela_, d7belb2, d7belc_, d7beld2, d7belr_, d7belx_
   automated match to d4odhl1
   complexed with act, bma, gol, man, nag

Details for d7bell1

PDB Entry: 7bel, 2.53 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-88 and covox-45 fabs

PDB Compounds: (L:) COVOX-88 light chain

SCOPe Domain Sequences for d7bell1:

Sequence; same for both SEQRES and ATOM records:

>d7bell1 b.1.1.0 (L:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqppsvseaprqrvtiscsgsssnignnavnwyqqfpgkapklliyyddllpsgvs
drfsgsksgtsaslaisgvqsedeadyycaawdds

Timeline for d7bell1:

• d7bell1 first appeared in SCOPe 2.07