Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.4: NTF2-like [54427] (4 families) |
Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein) |
Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) |
Species Pseudomonas putida [TaxId:303] [54440] (2 PDB entries) |
Domain d1ndof_: 1ndo F: [38123] Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2 |
PDB Entry: 1ndo (more details), 2.25 Å
SCOP Domain Sequences for d1ndof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndof_ d.17.4.4 (F:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1ndof_: