Lineage for d1ndob_ (1ndo B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78540Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 78604Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)
  6. 78605Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)
  7. 78606Species Pseudomonas putida [TaxId:303] [54440] (2 PDB entries)
  8. 78608Domain d1ndob_: 1ndo B: [38121]
    Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2

Details for d1ndob_

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndob_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOP Domain Coordinates for d1ndob_:

Click to download the PDB-style file with coordinates for d1ndob_.
(The format of our PDB-style files is described here.)

Timeline for d1ndob_: