Lineage for d1ndoc1 (1ndo C:1-154)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.2: Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50033] (1 protein) Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species) Species Pseudomonas putida [TaxId:303] [50035] (2 PDB entries) 
Domain d1ndoc1: 1ndo C:1-154 [24445]
Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_
Details for d1ndoc1
PDB Entry: 1ndo (more details), 2.25 Å
PDB Description: napthalene 1,2-dioxygenase
SCOP Domain Sequences for d1ndoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndoc1 b.33.1.2 (C:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq
SCOP Domain Coordinates for d1ndoc1:
Click to download the PDB-style file with coordinates for d1ndoc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ndoc1:
View in 3D
