Lineage for d6rhwc_ (6rhw C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892209Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2892210Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)
  8. 2892230Domain d6rhwc_: 6rhw C: [378392]
    Other proteins in same PDB: d6rhwg_, d6rhwh_
    automated match to d1aoxa_
    complexed with dms, mg

Details for d6rhwc_

PDB Entry: 6rhw (more details), 2.75 Å

PDB Description: crystal structure of human cd11b i-domain (cd11b-i) in complex with staphylococcus aureus octameric bi-component leukocidin lukgh
PDB Compounds: (C:) Integrin alpha-M

SCOPe Domain Sequences for d6rhwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rhwc_ c.62.1.1 (C:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqv

SCOPe Domain Coordinates for d6rhwc_:

Click to download the PDB-style file with coordinates for d6rhwc_.
(The format of our PDB-style files is described here.)

Timeline for d6rhwc_: