Lineage for d6rhwg_ (6rhw G:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576300Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2576301Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2576428Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 2576429Protein automated matches [227114] (6 species)
    not a true protein
  7. 3078325Species Staphylococcus aureus [TaxId:1280] [378387] (3 PDB entries)
  8. 3078329Domain d6rhwg_: 6rhw G: [378391]
    Other proteins in same PDB: d6rhwc_
    automated match to d2qk7b_
    complexed with dms, mg

Details for d6rhwg_

PDB Entry: 6rhw (more details), 2.75 Å

PDB Description: crystal structure of human cd11b i-domain (cd11b-i) in complex with staphylococcus aureus octameric bi-component leukocidin lukgh
PDB Compounds: (G:) Beta-channel forming cytolysin

SCOPe Domain Sequences for d6rhwg_:

Sequence, based on SEQRES records: (download)

>d6rhwg_ f.6.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildpngywns
tlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktggdfsinrggltgni
tkesnysetisyqqpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnrtks
eifsltrngnlwakdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykrsmd
efkidwnrhgfwgywsgenhvdkkeeklsalyevdwkthnvkfvkvln

Sequence, based on observed residues (ATOM records): (download)

>d6rhwg_ f.6.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildpngywns
tlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktnitkesnysetisyq
qpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnrtkseifsltrngnlwa
kdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykrsmdefkidwnrhgyws
genhvdkkeeklsalyevdwkthnvkfvkvln

SCOPe Domain Coordinates for d6rhwg_:

Click to download the PDB-style file with coordinates for d6rhwg_.
(The format of our PDB-style files is described here.)

Timeline for d6rhwg_:

  • d6rhwg_ is new in SCOPe 2.07-stable