![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
![]() | Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
![]() | Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
![]() | Protein automated matches [227114] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [378387] (3 PDB entries) |
![]() | Domain d6rhwg_: 6rhw G: [378391] Other proteins in same PDB: d6rhwc_ automated match to d2qk7b_ complexed with dms, mg |
PDB Entry: 6rhw (more details), 2.75 Å
SCOPe Domain Sequences for d6rhwg_:
Sequence, based on SEQRES records: (download)
>d6rhwg_ f.6.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 1280]} dtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildpngywns tlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktggdfsinrggltgni tkesnysetisyqqpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnrtks eifsltrngnlwakdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykrsmd efkidwnrhgfwgywsgenhvdkkeeklsalyevdwkthnvkfvkvln
>d6rhwg_ f.6.1.0 (G:) automated matches {Staphylococcus aureus [TaxId: 1280]} dtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildpngywns tlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktnitkesnysetisyq qpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnrtkseifsltrngnlwa kdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykrsmdefkidwnrhgyws genhvdkkeeklsalyevdwkthnvkfvkvln
Timeline for d6rhwg_: