PDB entry 6rhw

View 6rhw on RCSB PDB site
Description: Crystal structure of human CD11b I-domain (CD11b-I) in complex with Staphylococcus aureus octameric bi-component leukocidin LukGH
Class: toxin
Keywords: LEUKOCIDIN, PORE-FORMING TOXIN, OCTAMER, receptor, complex, TOXIN
Deposited on 2019-04-23, released 2019-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rhwc_
  • Chain 'G':
    Compound: Beta-channel forming cytolysin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: lukG, ELQ85_15505, EP54_11070, EQ90_09460, HMPREF3211_02235, NCTC10654_02179, NCTC10702_03203, NCTC13131_01350, RK64_10675
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rhwg_
  • Chain 'H':
    Compound: Beta-channel forming cytolysin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: lukH, BTN44_11630, EP54_11065, EQ90_09455, HMPREF3211_02234, NCTC10654_02180, NCTC10702_03204, NCTC13131_01351, NCTC13196_01958, RK64_10680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rhwh_
  • Heterogens: DMS, MG, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6rhwC (C:)
    gcpqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftf
    kefqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekf
    gdplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealk
    tiqnqlrekifaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rhwC (C:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6rhwG (G:)
    kinseikqvseknldgdtkmytrtattsdsqknitqslqfnfltepnydketvfikakgt
    igsglrildpngywnstlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyk
    tggdfsinrggltgnitkesnysetisyqqpsyrtlldqstshkgvgwkveahlinnmgh
    dhtrqltndsdnrtkseifsltrngnlwakdnftpkdkmpvtvsegfnpeflavmshdkk
    dkgksqfvvhykrsmdefkidwnrhgfwgywsgenhvdkkeeklsalyevdwkthnvkfv
    kvlndnekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rhwG (G:)
    dtkmytrtattsdsqknitqslqfnfltepnydketvfikakgtigsglrildpngywns
    tlrwpgsysvsiqnvddnnntnvtdfapknqdesrevkytygyktnitkesnysetisyq
    qpsyrtlldqstshkgvgwkveahlinnmghdhtrqltndsdnrtkseifsltrngnlwa
    kdnftpkdkmpvtvsegfnpeflavmshdkkdkgksqfvvhykrsmdefkidwnrhgyws
    genhvdkkeeklsalyevdwkthnvkfvkvln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6rhwH (H:)
    nsahkdsqdqnkkehvdksqqkdkrnvtnkdknstapddigkngkitkrtetvydektni
    lqnlqfdfiddptydknvllvkkqgsihsnlkfeshkeeknsnwlkypseyhvdfqvkrn
    rkteildqlpknkistakvdstfsyssggkfdstkgigrtssnsysktisynqqnydtia
    sgknnnwhvhwsviandlkyggevknrndellfyrntriatvenpelsfaskyrypalvr
    sgfnpefltylsneksnektqfevtytrnqdilknrpgihyappileknkdgqrlivtye
    vdwknktvkvvdkysddnkpykeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rhwH (H:)
    kitkrtetvydektnilqnlqfdfiddptydknvllvkkqgsihsnlkfeshkeeknsnw
    lkypseyhvdfqvkrnrkteildqlpknkistakvdstfsyssggkftssnsysktisyn
    qqnydtiasgknnnwhvhwsviandlkyggevknrndellfyrntriatvenpelsfask
    yrypalvrsgfnpefltylsneksnektqfevtytrnqdilknrpgiyappileknkdgq
    rlivtyevdwknktvkvvdkysddnkpykeg