Lineage for d6rhwh_ (6rhw H:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576300Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 2576301Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 2576428Family f.6.1.0: automated matches [227293] (1 protein)
    not a true family
  6. 2576429Protein automated matches [227114] (6 species)
    not a true protein
  7. 2576447Species Staphylococcus aureus [TaxId:451516] [260976] (2 PDB entries)
  8. 3078331Domain d6rhwh_: 6rhw H: [378393]
    Other proteins in same PDB: d6rhwc_
    automated match to d4tw1b_
    complexed with dms, mg

Details for d6rhwh_

PDB Entry: 6rhw (more details), 2.75 Å

PDB Description: crystal structure of human cd11b i-domain (cd11b-i) in complex with staphylococcus aureus octameric bi-component leukocidin lukgh
PDB Compounds: (H:) Beta-channel forming cytolysin

SCOPe Domain Sequences for d6rhwh_:

Sequence, based on SEQRES records: (download)

>d6rhwh_ f.6.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 451516]}
kitkrtetvydektnilqnlqfdfiddptydknvllvkkqgsihsnlkfeshkeeknsnw
lkypseyhvdfqvkrnrkteildqlpknkistakvdstfsyssggkfdstkgigrtssns
ysktisynqqnydtiasgknnnwhvhwsviandlkyggevknrndellfyrntriatven
pelsfaskyrypalvrsgfnpefltylsneksnektqfevtytrnqdilknrpgihyapp
ileknkdgqrlivtyevdwknktvkvvdkysddnkpykeg

Sequence, based on observed residues (ATOM records): (download)

>d6rhwh_ f.6.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 451516]}
kitkrtetvydektnilqnlqfdfiddptydknvllvkkqgsihsnlkfeshkeeknsnw
lkypseyhvdfqvkrnrkteildqlpknkistakvdstfsyssggkftssnsysktisyn
qqnydtiasgknnnwhvhwsviandlkyggevknrndellfyrntriatvenpelsfask
yrypalvrsgfnpefltylsneksnektqfevtytrnqdilknrpgiyappileknkdgq
rlivtyevdwknktvkvvdkysddnkpykeg

SCOPe Domain Coordinates for d6rhwh_:

Click to download the PDB-style file with coordinates for d6rhwh_.
(The format of our PDB-style files is described here.)

Timeline for d6rhwh_:

  • d6rhwh_ is new in SCOPe 2.07-stable