Lineage for d6pfyo_ (6pfy O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005550Protein Photosystem I subunit PsaD [64236] (2 species)
  7. 3005553Species Thermosynechococcus elongatus [TaxId:197221] [377957] (5 PDB entries)
  8. 3005559Domain d6pfyo_: 6pfy O: [377958]
    Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
    automated match to d1jb0d_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyo_

PDB Entry: 6pfy (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a
PDB Compounds: (O:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6pfyo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfyo_ d.187.1.1 (O:) Photosystem I subunit PsaD {Thermosynechococcus elongatus [TaxId: 197221]}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

SCOPe Domain Coordinates for d6pfyo_:

Click to download the PDB-style file with coordinates for d6pfyo_.
(The format of our PDB-style files is described here.)

Timeline for d6pfyo_: