![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
![]() | Protein automated matches [236583] (4 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377791] (4 PDB entries) |
![]() | Domain d6pfyf_: 6pfy F: [377885] Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfye_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_ automated match to d1jb0f_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pfy (more details), 2.9 Å
SCOPe Domain Sequences for d6pfyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfyf_ f.23.16.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa lkelasgeltakdneitvspr
Timeline for d6pfyf_: