Lineage for d6pfyh_ (6pfy h:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027934Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 3027938Protein automated matches [347525] (2 species)
    not a true protein
  7. 3027944Species Thermosynechococcus elongatus [TaxId:197221] [377769] (5 PDB entries)
  8. 3027950Domain d6pfyh_: 6pfy h: [377922]
    Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyi_, d6pfyj_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfyh_

PDB Entry: 6pfy (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a
PDB Compounds: (h:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6pfyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfyh_ f.31.1.1 (h:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv
klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag
ffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d6pfyh_:

Click to download the PDB-style file with coordinates for d6pfyh_.
(The format of our PDB-style files is described here.)

Timeline for d6pfyh_: