![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
![]() | Protein automated matches [347525] (2 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377769] (5 PDB entries) |
![]() | Domain d6pfyh_: 6pfy h: [377922] Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyi_, d6pfyj_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_ automated match to d1jb0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pfy (more details), 2.9 Å
SCOPe Domain Sequences for d6pfyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfyh_ f.31.1.1 (h:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} lvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpwv klgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqftag ffvgamgsafvaffllenflvvdgimtglfn
Timeline for d6pfyh_: