SCOPe 2.08: Domain d6pfye_: 6pfy e:

Lineage for d6pfye_ (6pfy e:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family)

5. Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)

6. Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377780] (5 PDB entries)

8. Domain d6pfye_: 6pfy e: [377781]
   Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
   automated match to d1jb0i_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfye_

PDB Entry: 6pfy, 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a

PDB Compounds: (e:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6pfye_:

Sequence; same for both SEQRES and ATOM records:

>d6pfye_ f.23.17.1 (e:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

Timeline for d6pfye_:

• d6pfye_ first appeared in SCOPe 2.07